![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
![]() | Protein automated matches [226935] (30 species) not a true protein |
![]() | Species Mycobacterium smegmatis [TaxId:246196] [226168] (3 PDB entries) |
![]() | Domain d4iv6a2: 4iv6 A:227-384 [223418] Other proteins in same PDB: d4iv6a1, d4iv6b1 automated match to d1ukwa1 complexed with fda |
PDB Entry: 4iv6 (more details), 2 Å
SCOPe Domain Sequences for d4iv6a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iv6a2 a.29.3.0 (A:227-384) automated matches {Mycobacterium smegmatis [TaxId: 246196]} egrgfaqmmkglevgrlqvaaratgvaraafedalrysqeresfgkpiwqhqsvgnmlad mgtklyaarslllsaaekfdagqrcdmeagmaklfasetamqialdavrvhggygystey dveryfrdaplmivgegtneiqrnviakqlvarggldi
Timeline for d4iv6a2: