SCOPe 2.03: Domain d4iv5e1: 4iv5 E:3-157

Lineage for d4iv5e1 (4iv5 E:3-157)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (20 species)
   not a true protein

7. Species Trypanosoma cruzi [TaxId:353153] [226636] (1 PDB entry)

8. Domain d4iv5e1: 4iv5 E:3-157 [223413]
   automated match to d1ml4a1
   complexed with edo, po4, unx

Details for d4iv5e1

PDB Entry: 4iv5, 2.1 Å

PDB Description: X-ray crystal structure of a putative aspartate carbamoyltransferase from Trypanosoma cruzi

PDB Compounds: (E:) Aspartate carbamoyltransferase, putative

SCOPe Domain Sequences for d4iv5e1:

Sequence, based on SEQRES records:

>d4iv5e1 c.78.1.0 (E:3-157) automated matches {Trypanosoma cruzi [TaxId: 353153]}
elppvaslkgksitsaeqfsradiyalihlasamqrkidagevlnllqgrimtplffeds
srtfssfcaamirlggsvvnfkveassinkgetladtirtldsysdvlvmrhprqdaiee
alsvaqhpilnagngagehptqalldtltihselg

Sequence, based on observed residues (ATOM records):

>d4iv5e1 c.78.1.0 (E:3-157) automated matches {Trypanosoma cruzi [TaxId: 353153]}
elppvaslkgksitsaeqfsradiyalihlasamqrkidagevlnllqgrimtplffeds
srtfssfcaamirlggsvvnfkvetladtirtldsysdvlvmrhprqdaieealsvaqhp
ilnagngagehptqalldtltihselg

Timeline for d4iv5e1:

• d4iv5e1 is new in SCOPe 2.03-stable
  
• d4iv5e1 appears in SCOPe 2.04
  
• d4iv5e1 appears in the current release, SCOPe 2.08