Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (20 species) not a true protein |
Species Trypanosoma cruzi [TaxId:353153] [226636] (1 PDB entry) |
Domain d4iv5b1: 4iv5 B:3-157 [223407] automated match to d1ml4a1 complexed with edo, po4, unx |
PDB Entry: 4iv5 (more details), 2.1 Å
SCOPe Domain Sequences for d4iv5b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iv5b1 c.78.1.0 (B:3-157) automated matches {Trypanosoma cruzi [TaxId: 353153]} elppvaslkgksitsaeqfsradiyalihlasamqrkidagevlnllqgrimtplffeds srtfssfcaamirlggsvvnfkveassinkgetladtirtldsysdvlvmrhprqdaiee alsvaqhpilnagngagehptqalldtltihselg
Timeline for d4iv5b1: