SCOPe 2.04: Domain d4iv1a_: 4iv1 A:

Lineage for d4iv1a_ (4iv1 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (9 species)
   not a true protein

7. Species Foot-and-mouth disease virus - type a [TaxId:12111] [196861] (3 PDB entries)

8. Domain d4iv1a_: 4iv1 A: [223403]
   automated match to d4iv3a_

Details for d4iv1a_

PDB Entry: 4iv1, 2.1 Å

PDB Description: Crystal structure of recombinant foot-and-mouth-disease virus A22 empty capsid

PDB Compounds: (A:) Capsid protein VP1

SCOPe Domain Sequences for d4iv1a_:

Sequence, based on SEQRES records:

>d4iv1a_ b.121.4.1 (A:) automated matches {Foot-and-mouth disease virus - type a [TaxId: 12111]}
ttttgesadpvtttvenyggetqvqrrqhtdvtfimdrfvkiqnlnpthvidlmqthqhg
lvgallraatyyfsdleivvrhdgnltwvpngapeaalsntgnptaylkapftrlalpyt
aphrvlatvyngtskysaggtgrrgdlgplaarvaaqlpasfnfgaiqattihellvrmk
raelycprpllavevssqdrhkqkiiapak

Sequence, based on observed residues (ATOM records):

>d4iv1a_ b.121.4.1 (A:) automated matches {Foot-and-mouth disease virus - type a [TaxId: 12111]}
ttttgesadpvtttvenyggetqvqrrqhtdvtfimdrfvkiqnlnpthvidlmqthqhg
lvgallraatyyfsdleivvrhdgnltwvpngapeaalsntgnptaylkapftrlalpyt
aphrvlatvyngtskyaqlpasfnfgaiqattihellvrmkraelycprpllavevssqd
rhkqkiiapak

Timeline for d4iv1a_:

• d4iv1a_ first appeared in SCOPe 2.03
  
• d4iv1a_ appears in SCOPe 2.05
  
• d4iv1a_ appears in the current release, SCOPe 2.08