Lineage for d2mspf_ (2msp F:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10236Superfamily b.1.11: PapD-like [49354] (2 families) (S)
  5. 10257Family b.1.11.2: Major sperm protein, alpha isoform (recombinant), ph 4.6 [49360] (1 protein)
  6. 10258Protein Major sperm protein, alpha isoform (recombinant), ph 4.6 [49361] (1 species)
  7. 10259Species Pig roundworm (Ascaris suum) [TaxId:6253] [49362] (3 PDB entries)
  8. 10267Domain d2mspf_: 2msp F: [22340]

Details for d2mspf_

PDB Entry: 2msp (more details), 3.3 Å

PDB Description: major sperm protein, beta isoform, engineered c59s/t90c mutant, putative subfilament structure, ph 8.5

SCOP Domain Sequences for d2mspf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mspf_ b.1.11.2 (F:) Major sperm protein, alpha isoform (recombinant), ph 4.6 {Pig roundworm (Ascaris suum)}
svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
eynl

SCOP Domain Coordinates for d2mspf_:

Click to download the PDB-style file with coordinates for d2mspf_.
(The format of our PDB-style files is described here.)

Timeline for d2mspf_: