SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2mspf_ (2msp F:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2031706Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2031795Family b.1.11.2: MSP-like [49360] (4 protein domains)
    Pfam PF00635
  6. 2031796Protein Major sperm protein, MSP [49361] (2 species)
  7. 2031802Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (4 PDB entries)
  8. 2031814Domain d2mspf_: 2msp F: [22340]
    mutant

Details for d2mspf_

PDB Entry: 2msp (more details), 3.3 Å

PDB Description: major sperm protein, beta isoform, engineered c59s/t90c mutant, putative subfilament structure, ph 8.5
PDB Compounds: (F:) major sperm protein

SCOPe Domain Sequences for d2mspf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mspf_ b.1.11.2 (F:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]}
svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
eynl

SCOPe Domain Coordinates for d2mspf_:

Click to download the PDB-style file with coordinates for d2mspf_.
(The format of our PDB-style files is described here.)

Timeline for d2mspf_: