Lineage for d4iuyd_ (4iuy D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2106806Species Acinetobacter baumannii [TaxId:405416] [226610] (1 PDB entry)
  8. 2106810Domain d4iuyd_: 4iuy D: [223398]
    automated match to d2rhcb_

Details for d4iuyd_

PDB Entry: 4iuy (more details), 2.38 Å

PDB Description: crystal structure of short-chain dehydrogenase/reductase (apo-form) from a. baumannii clinical strain wm99c
PDB Compounds: (D:) Short chain dehydrogenase/reductase

SCOPe Domain Sequences for d4iuyd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iuyd_ c.2.1.0 (D:) automated matches {Acinetobacter baumannii [TaxId: 405416]}
nifdvkdkyilitgassglghhiaelfakeganivicarrlerlkeleshikneygvqvy
tfaldvndrsavkdmlssleaegvtidvlinnagvsdtkrfldyndedwdkivdtnlkap
wqcaqevvqhmikaerkgsiinitsilsqstnlgvspycaskaglrhltevmavelarfg
invnaiapgymiteineeyltsevgqqllkkiptrkfvefddlngpllllasqagqgitg
ieikvdgghsaap

SCOPe Domain Coordinates for d4iuyd_:

Click to download the PDB-style file with coordinates for d4iuyd_.
(The format of our PDB-style files is described here.)

Timeline for d4iuyd_: