Lineage for d4iuyc_ (4iuy C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2845805Species Acinetobacter baumannii [TaxId:405416] [226610] (1 PDB entry)
  8. 2845808Domain d4iuyc_: 4iuy C: [223397]
    automated match to d2rhcb_

Details for d4iuyc_

PDB Entry: 4iuy (more details), 2.39 Å

PDB Description: crystal structure of short-chain dehydrogenase/reductase (apo-form) from a. baumannii clinical strain wm99c
PDB Compounds: (C:) Short chain dehydrogenase/reductase

SCOPe Domain Sequences for d4iuyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iuyc_ c.2.1.0 (C:) automated matches {Acinetobacter baumannii [TaxId: 405416]}
nifdvkdkyilitgassglghhiaelfakeganivicarrlerlkeleshikneygvqvy
tfaldvndrsavkdmlssleaegvtidvlinnagvsdtkrfldyndedwdkivdtnlkap
wqcaqevvqhmikaerkgsiinitsilsqstnlgvspycaskaglrhltevmavelarfg
invnaiapgymiteineeyltsevgqqllkkiptrkfvefddlngpllllasqagqgitg
ieikvdgghsaapi

SCOPe Domain Coordinates for d4iuyc_:

Click to download the PDB-style file with coordinates for d4iuyc_.
(The format of our PDB-style files is described here.)

Timeline for d4iuyc_: