Lineage for d4iu1a_ (4iu1 A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1367036Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 1367037Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 1367379Family c.42.1.0: automated matches [191435] (1 protein)
    not a true family
  6. 1367380Protein automated matches [190626] (6 species)
    not a true protein
  7. 1367415Species Trypanosome (Leishmania mexicana) [TaxId:5665] [226579] (5 PDB entries)
  8. 1367419Domain d4iu1a_: 4iu1 A: [223390]
    automated match to d1wvaa1
    complexed with gol, mn, nnh

Details for d4iu1a_

PDB Entry: 4iu1 (more details), 1.95 Å

PDB Description: Crystal structure of Leishmania mexicana arginase in complex with inhibitor nor-NOHA
PDB Compounds: (A:) arginase

SCOPe Domain Sequences for d4iu1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iu1a_ c.42.1.0 (A:) automated matches {Trypanosome (Leishmania mexicana) [TaxId: 5665]}
kkmsivlapfsggqphsgvelgpdyllkqglqqdmeklgwdtrlervfdgkvvearkasd
ngdrigrvkrprltaectekiykcvrrvaeqgrfpltiggdhsialgtvagvlsvhpdag
viwvdahadintmsgtvsgnlhgcplsillgldrenipecfswvpqvlkpnkiayiglra
vddeekkilhdlniaafsmhhvdrygidkvvsmaieavspkgtepvmvsydvdtidplyv
patgtpvrgglsfrealflceriaecgrlvaldvvecnpllaateshvndtisvgcaiar
cmmgetllyt

SCOPe Domain Coordinates for d4iu1a_:

Click to download the PDB-style file with coordinates for d4iu1a_.
(The format of our PDB-style files is described here.)

Timeline for d4iu1a_: