![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.11: PapD-like [49354] (2 families) ![]() contains PP switch between strands D and C' |
![]() | Family b.1.11.2: MSP-like [49360] (4 proteins) Pfam PF00635 |
![]() | Protein Major sperm protein, MSP [49361] (2 species) |
![]() | Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (3 PDB entries) |
![]() | Domain d2mspe_: 2msp E: [22339] |
PDB Entry: 2msp (more details), 3.3 Å
SCOP Domain Sequences for d2mspe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mspe_ b.1.11.2 (E:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]} svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi eynl
Timeline for d2mspe_: