Lineage for d4itua_ (4itu A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2109328Species Xanthobacter autotrophicus [TaxId:78245] [187540] (3 PDB entries)
  8. 2109329Domain d4itua_: 4itu A: [223376]
    automated match to d2pd6a_
    complexed with 1hs, nai

Details for d4itua_

PDB Entry: 4itu (more details), 1.6 Å

PDB Description: crystal structure of s-2-hydroxypropyl coenzyme m dehydrogenase (s-hpcdh) bound to s-hpc and nadh
PDB Compounds: (A:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d4itua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4itua_ c.2.1.0 (A:) automated matches {Xanthobacter autotrophicus [TaxId: 78245]}
nrlkneviaitgggagiglaiasaalregakvalidldqglaersaamlstggavakgfg
advtkaaditaaitsaeqtigsltglvnnagiagfgsvhdadaaawdrimavnvtgtfla
skaalagmlerhkgtivnfgsvaglvgiptmaaycaakgaivnltrqmaadysgrgvrvn
avcpgtvtstgmgqqllgsdtspevqarrlakypigrfgtpediaeavifllsdqaafvt
gaafavdggmtai

SCOPe Domain Coordinates for d4itua_:

Click to download the PDB-style file with coordinates for d4itua_.
(The format of our PDB-style files is described here.)

Timeline for d4itua_: