![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Non-hem ferritin [63524] (7 species) |
![]() | Species Pseudo-nitzschia multiseries [TaxId:37319] [188675] (9 PDB entries) |
![]() | Domain d4ittg_: 4itt G: [223374] automated match to d3e6sa_ complexed with fe |
PDB Entry: 4itt (more details), 2.1 Å
SCOPe Domain Sequences for d4ittg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ittg_ a.25.1.1 (G:) Non-hem ferritin {Pseudo-nitzschia multiseries [TaxId: 37319]} elldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfankr nipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmaflnp fhlqqvneedkigsilakvtdenrtpgllrsldvvs
Timeline for d4ittg_: