Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.11: PapD-like [49354] (2 families) contains PP switch between strands D and C' |
Family b.1.11.2: MSP-like [49360] (4 proteins) Pfam PF00635 |
Protein Major sperm protein, MSP [49361] (2 species) |
Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (3 PDB entries) |
Domain d2mspc_: 2msp C: [22337] |
PDB Entry: 2msp (more details), 3.3 Å
SCOP Domain Sequences for d2mspc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mspc_ b.1.11.2 (C:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]} svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi eynl
Timeline for d2mspc_: