![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (95 species) not a true protein |
![]() | Species Pseudomonas fluorescens [TaxId:205922] [226578] (1 PDB entry) |
![]() | Domain d4it1c1: 4it1 C:1-135 [223364] Other proteins in same PDB: d4it1a2, d4it1a3, d4it1b2, d4it1b3, d4it1c2, d4it1c3, d4it1d2, d4it1d3 automated match to d1ec7a2 complexed with bct, k, mg, tla |
PDB Entry: 4it1 (more details), 2.2 Å
SCOPe Domain Sequences for d4it1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4it1c1 d.54.1.0 (C:1-135) automated matches {Pseudomonas fluorescens [TaxId: 205922]} mkitrvtvtpiafrdppllnasgihepfalrsiieiesdngyiglgesygdapalaiqqq vqsqligldpfnlnqlrrivqttvaahkpaslagaelapgshaskavsnaysafevafld lqarylnvplvdllg
Timeline for d4it1c1: