SCOP 1.61: Domain d2mspb_: 2msp B:

Lineage for d2mspb_ (2msp B:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.11: PapD-like [49354] (2 families)

5. Family b.1.11.2: Major sperm protein [49360] (1 protein)

6. Protein Major sperm protein [49361] (2 species)

7. Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (3 PDB entries)

8. Domain d2mspb_: 2msp B: [22336]

Details for d2mspb_

PDB Entry: 2msp, 3.3 Å

PDB Description: major sperm protein, beta isoform, engineered c59s/t90c mutant, putative subfilament structure, ph 8.5

SCOP Domain Sequences for d2mspb_:

Sequence; same for both SEQRES and ATOM records:

>d2mspb_ b.1.11.2 (B:) Major sperm protein {Pig roundworm (Ascaris suum), alpha isoform}
svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
eynl

Timeline for d2mspb_:

• d2mspb_ first appeared (with stable ids) in SCOP 1.55
  
• d2mspb_ appears in SCOP 1.59
  
• d2mspb_ appears in SCOP 1.63
  
• d2mspb_ appears in the current release, SCOPe 2.08