Lineage for d2mspb_ (2msp B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764596Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 2764689Family b.1.11.2: MSP-like [49360] (4 proteins)
    Pfam PF00635
  6. 2764690Protein Major sperm protein, MSP [49361] (2 species)
  7. 2764696Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (4 PDB entries)
  8. 2764704Domain d2mspb_: 2msp B: [22336]
    mutant

Details for d2mspb_

PDB Entry: 2msp (more details), 3.3 Å

PDB Description: major sperm protein, beta isoform, engineered c59s/t90c mutant, putative subfilament structure, ph 8.5
PDB Compounds: (B:) major sperm protein

SCOPe Domain Sequences for d2mspb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mspb_ b.1.11.2 (B:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]}
svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
eynl

SCOPe Domain Coordinates for d2mspb_:

Click to download the PDB-style file with coordinates for d2mspb_.
(The format of our PDB-style files is described here.)

Timeline for d2mspb_: