SCOPe 2.08: Domain d4isva2: 4isv A:117-217

Lineage for d4isva2 (4isv A:117-217)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4isva2: 4isv A:117-217 [223357]
   Other proteins in same PDB: d4isvb_
   automated match to d1nj9a2

Details for d4isva2

PDB Entry: 4isv, 1.5 Å

PDB Description: crystal structure of the fab fragment of 1c2, a monoclonal antibody specific for poly-glutamine

PDB Compounds: (A:) 1c2 fab light chain

SCOPe Domain Sequences for d4isva2:

Sequence; same for both SEQRES and ATOM records:

>d4isva2 b.1.1.0 (A:117-217) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qpkstptltvfppsseelkenkatlvclisnfspsgvtvawkangtpitqgvdtsnptke
gnkfmassflhltsdqwrshnsftcqvthegdtvekslspa

Timeline for d4isva2:

• d4isva2 first appeared in SCOPe 2.03
  
• d4isva2 appears in SCOPe 2.07