Lineage for d4isva1 (4isv A:1-116)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759561Domain d4isva1: 4isv A:1-116 [223356]
    Other proteins in same PDB: d4isvb_
    automated match to d1nj9a1

Details for d4isva1

PDB Entry: 4isv (more details), 1.5 Å

PDB Description: crystal structure of the fab fragment of 1c2, a monoclonal antibody specific for poly-glutamine
PDB Compounds: (A:) 1c2 fab light chain

SCOPe Domain Sequences for d4isva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4isva1 b.1.1.0 (A:1-116) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qlvltqsssasfslgasakltctlsrqhstytiewyqqqplkppkfvmelkkdgshstgd
gipdrfsgsssgahrylsisniqpedeaiyicgvgdtikeqfvyvfgggtkvtvlg

SCOPe Domain Coordinates for d4isva1:

Click to download the PDB-style file with coordinates for d4isva1.
(The format of our PDB-style files is described here.)

Timeline for d4isva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4isva2
View in 3D
Domains from other chains:
(mouse over for more information)
d4isvb_