SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4ismd_ (4ism D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1988413Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1988414Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1988415Family a.25.1.1: Ferritin [47241] (10 protein domains)
  6. 1989243Protein Non-hem ferritin [63524] (7 species)
  7. 1989262Species Pseudo-nitzschia multiseries [TaxId:37319] [188675] (9 PDB entries)
  8. 1989286Domain d4ismd_: 4ism D: [223351]
    automated match to d3e6sa_
    complexed with zn

Details for d4ismd_

PDB Entry: 4ism (more details), 2 Å

PDB Description: Crystal structure of ferritin from Pseudo-nitzschia multiseries soaked with zinc
PDB Compounds: (D:) Ferritin

SCOPe Domain Sequences for d4ismd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ismd_ a.25.1.1 (D:) Non-hem ferritin {Pseudo-nitzschia multiseries [TaxId: 37319]}
seelldlfnrqvtqeftasqvylsasiwfdqndwegmaaymlaesaeerehglgfvdfan
krnipielqavpapvscaewsspedvwqsileleqantrsllnlaeaastchdfavmafl
npfhlqqvneedkigsilakvtdenrtpgllrsldvvsf

SCOPe Domain Coordinates for d4ismd_:

Click to download the PDB-style file with coordinates for d4ismd_.
(The format of our PDB-style files is described here.)

Timeline for d4ismd_: