SCOPe 2.08: Domain d4islb_: 4isl B:

Lineage for d4islb_ (4isl B:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.0: automated matches [191505] (1 protein)
   not a true family

6. Protein automated matches [190829] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188132] (10 PDB entries)

8. Domain d4islb_: 4isl B: [223347]
   Other proteins in same PDB: d4isla_
   automated match to d4isob_
   complexed with gol, gsh, pg4, pge

Details for d4islb_

PDB Entry: 4isl, 2.29 Å

PDB Description: crystal structure of the inactive matriptase in complex with its inhibitor hai-1

PDB Compounds: (B:) Kunitz-type protease inhibitor 1

SCOPe Domain Sequences for d4islb_:

Sequence; same for both SEQRES and ATOM records:

>d4islb_ g.8.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qtedyclasnkvgrcrgsfprwyydpteqicksfvyggclgnknnylreeecilacrgvq

Timeline for d4islb_:

• d4islb_ first appeared in SCOPe 2.03
  
• d4islb_ appears in SCOPe 2.07