SCOPe 2.08: Domain d4isla_: 4isl A:

Lineage for d4isla_ (4isl A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Matriptase MTSP1 [69284] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69285] (21 PDB entries)

8. Domain d4isla_: 4isl A: [223346]
   Other proteins in same PDB: d4islb_
   automated match to d4is5a_
   complexed with gol, gsh, pg4, pge

Details for d4isla_

PDB Entry: 4isl, 2.29 Å

PDB Description: crystal structure of the inactive matriptase in complex with its inhibitor hai-1

PDB Compounds: (A:) Suppressor of tumorigenicity 14 protein

SCOPe Domain Sequences for d4isla_:

Sequence; same for both SEQRES and ATOM records:

>d4isla_ b.47.1.2 (A:) Matriptase MTSP1 {Human (Homo sapiens) [TaxId: 9606]}
vvggtdadegewpwqvslhalgqghicgaslispnwlvsaahcyiddrgfrysdptqwta
flglhdqsqrsapgvqerrlkriishpffndftfdydiallelekpaeyssmvrpiclpd
ashvfpagkaiwvtgwghtqyggtgalilqkgeirviqqttcenllpqqitprmmcvgfl
sggvdscqgdaggplssveadgrifqagvvswgdgcaqrnkpgvytrlplfrdwikentg
v

Timeline for d4isla_:

• d4isla_ first appeared in SCOPe 2.03
  
• d4isla_ appears in SCOPe 2.07