Lineage for d4isja_ (4isj A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009107Fold d.261: Hypothetical protein PH1602 [103364] (1 superfamily)
    complex alpha+beta fold; contains a region of similarity to the ferredoxin-like fold
  4. 3009108Superfamily d.261.1: Hypothetical protein PH1602 [103365] (2 families) (S)
  5. 3009109Family d.261.1.1: Hypothetical protein PH1602 [103366] (2 proteins)
    automatically mapped to Pfam PF01139
  6. 3009110Protein Hypothetical protein PH1602 [103367] (1 species)
  7. 3009111Species Pyrococcus horikoshii [TaxId:53953] [103368] (5 PDB entries)
  8. 3009116Domain d4isja_: 4isj A: [223344]
    automated match to d1uc2a_
    protein/RNA complex; complexed with mn, so4

Details for d4isja_

PDB Entry: 4isj (more details), 2.34 Å

PDB Description: rna ligase rtcb in complex with mn(ii)
PDB Compounds: (A:) tRNA-splicing ligase RtcB

SCOPe Domain Sequences for d4isja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4isja_ d.261.1.1 (A:) Hypothetical protein PH1602 {Pyrococcus horikoshii [TaxId: 53953]}
vvplkridkirweipkfdkrmrvpgrvyadevllekmkndrtleqatnvamlpgiykysi
vmpdghqgygfpiggvaafdvkegvispggigydincgvrlirtnltekevrprikqlvd
tlfknvpsgvgsqgriklhwtqiddvlvdgakwavdngygwerdlerleeggrmegadpe
avsqrakqrgapqlgslgsgnhflevqvvdkifdpevakayglfegqvvvmvhtgsrglg
hqvasdylrimerairkyripwpdrelvsvpfqseegqryfsamkaaanfawanrqmith
wvresfqevfkqdpegdlgmdivydvahnigkveehevdgkrvkvivhrkgatrafppgh
eavprlyrdvgqpvlipgsmgtasyilagtegamketfgstchgagrvlsrkaatrqyrg
drirqellnrgiyvraasmrvvaeeapgayknvdnvvkvvseagiaklvarmrpigvakg

SCOPe Domain Coordinates for d4isja_:

Click to download the PDB-style file with coordinates for d4isja_.
(The format of our PDB-style files is described here.)

Timeline for d4isja_: