Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) duplication contains two domains of this fold |
Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
Protein automated matches [226839] (49 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224896] (42 PDB entries) |
Domain d4isga2: 4isg A:219-465 [223343] automated match to d1bdga2 complexed with 1fy, glc, iod |
PDB Entry: 4isg (more details), 2.65 Å
SCOPe Domain Sequences for d4isga2:
Sequence, based on SEQRES records: (download)
>d4isga2 c.55.1.0 (A:219-465) automated matches {Human (Homo sapiens) [TaxId: 9606]} qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack kacmlgq
>d4isga2 c.55.1.0 (A:219-465) automated matches {Human (Homo sapiens) [TaxId: 9606]} qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrm ritvgvdgsvyklhpsfkerfhasvrrltpsceitfiesesgrgaalvsavackkacmlg q
Timeline for d4isga2: