| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (49 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [224896] (42 PDB entries) |
| Domain d4isfa2: 4isf A:219-465 [223341] automated match to d1bdga2 complexed with 1fx, glc, iod |
PDB Entry: 4isf (more details), 2.09 Å
SCOPe Domain Sequences for d4isfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4isfa2 c.55.1.0 (A:219-465) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd
essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv
esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs
edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack
kacmlgq
Timeline for d4isfa2: