SCOPe 2.03: Domain d4isfa1: 4isf A:9-218

Lineage for d4isfa1 (4isf A:9-218)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (35 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (31 PDB entries)

8. Domain d4isfa1: 4isf A:9-218 [223340]
   automated match to d1bdga1
   complexed with 1fx, glc, iod

Details for d4isfa1

PDB Entry: 4isf, 2.09 Å

PDB Description: human glucokinase in complex with novel activator (2s)-3-cyclohexyl-2- (6-fluoro-2,4-dioxo-1,4-dihydroquinazolin-3(2h)-yl)-n-(1,3-thiazol-2- yl)propanamide

PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d4isfa1:

Sequence, based on SEQRES records:

>d4isfa1 c.55.1.0 (A:9-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpmpltlveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpeg
sevgdflsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyise
cisdfldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrda
ikrrgdfemdvvamvndtvatmiscyyedh

Sequence, based on observed residues (ATOM records):

>d4isfa1 c.55.1.0 (A:9-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kpmpltlveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpse
vgdflsldlggtnfrvmlvkvgeqwsvktkhqmysipedamtgtaemlfdyisecisdfl
dkhqmkhkklplgftfsfpvrhnvvgllrdaikrrgdfemdvvamvndtvatmiscyyed
h

Timeline for d4isfa1:

• d4isfa1 is new in SCOPe 2.03-stable
  
• d4isfa1 appears in SCOPe 2.04
  
• d4isfa1 appears in the current release, SCOPe 2.08