SCOPe 2.01: Domain d1mspb_: 1msp B:

Lineage for d1mspb_ (1msp B:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.2: MSP-like [49360] (4 proteins)
   Pfam PF00635

6. Protein Major sperm protein, MSP [49361] (2 species)

7. Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (4 PDB entries)

8. Domain d1mspb_: 1msp B: [22334]

Details for d1mspb_

PDB Entry: 1msp, 2.5 Å

PDB Description: major sperm protein, alpha isoform (recombinant), ph 4.6

PDB Compounds: (B:) major sperm protein

SCOPe Domain Sequences for d1mspb_:

Sequence; same for both SEQRES and ATOM records:

>d1mspb_ b.1.11.2 (B:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]}
ppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcgvldp
kekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknlpiey
nl

Timeline for d1mspb_:

• d1mspb_ first appeared (with stable ids) in SCOP 1.55
  
• d1mspb_ appears in SCOP 1.75
  
• d1mspb_ appears in SCOPe 2.02
  
• d1mspb_ appears in the current release, SCOPe 2.08