Lineage for d1mspb_ (1msp B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10236Superfamily b.1.11: PapD-like [49354] (2 families) (S)
  5. 10257Family b.1.11.2: Major sperm protein, alpha isoform (recombinant), ph 4.6 [49360] (1 protein)
  6. 10258Protein Major sperm protein, alpha isoform (recombinant), ph 4.6 [49361] (1 species)
  7. 10259Species Pig roundworm (Ascaris suum) [TaxId:6253] [49362] (3 PDB entries)
  8. 10261Domain d1mspb_: 1msp B: [22334]

Details for d1mspb_

PDB Entry: 1msp (more details), 2.5 Å

PDB Description: major sperm protein, alpha isoform (recombinant), ph 4.6

SCOP Domain Sequences for d1mspb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mspb_ b.1.11.2 (B:) Major sperm protein, alpha isoform (recombinant), ph 4.6 {Pig roundworm (Ascaris suum)}
ppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcgvldp
kekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknlpiey
nl

SCOP Domain Coordinates for d1mspb_:

Click to download the PDB-style file with coordinates for d1mspb_.
(The format of our PDB-style files is described here.)

Timeline for d1mspb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mspa_