![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.11: PapD-like [49354] (3 families) ![]() contains PP switch between strands D and C' |
![]() | Family b.1.11.2: MSP-like [49360] (4 proteins) Pfam PF00635 |
![]() | Protein Major sperm protein, MSP [49361] (2 species) |
![]() | Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (4 PDB entries) |
![]() | Domain d1mspb_: 1msp B: [22334] |
PDB Entry: 1msp (more details), 2.5 Å
SCOPe Domain Sequences for d1mspb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mspb_ b.1.11.2 (B:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]} ppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcgvldp kekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknlpiey nl
Timeline for d1mspb_: