![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
![]() | Protein automated matches [226839] (35 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224896] (31 PDB entries) |
![]() | Domain d4isea2: 4ise A:219-465 [223339] automated match to d1bdga2 complexed with 1fw, glc, iod |
PDB Entry: 4ise (more details), 1.78 Å
SCOPe Domain Sequences for d4isea2:
Sequence, based on SEQRES records: (download)
>d4isea2 c.55.1.0 (A:219-465) automated matches {Human (Homo sapiens) [TaxId: 9606]} qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs edvmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavack kacmlgq
>d4isea2 c.55.1.0 (A:219-465) automated matches {Human (Homo sapiens) [TaxId: 9606]} qcevgmivgtgcnacymeemqnvelvegdegrmcvntewgafgdsgeldeflleydrlvd essanpgqqlyekliggkymgelvrlvllrlvdenllfhgeaseqlrtrgafetrfvsqv esdtgdrkqiynilstlglrpsttdcdivrracesvstraahmcsaglagvinrmresrs vmritvgvdgsvyklhpsfkerfhasvrrltpsceitfieseegsgrgaalvsavackka cmlgq
Timeline for d4isea2: