SCOPe 2.05: Domain d4irha_: 4irh A:

Lineage for d4irha_ (4irh A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (57 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186924] (11 PDB entries)

8. Domain d4irha_: 4irh A: [223335]
   automated match to d1mdmb_

Details for d4irha_

PDB Entry: 4irh, 2.1 Å

PDB Description: Auto-inhibited ERG Ets domain

PDB Compounds: (A:) Transcriptional regulator ERG

SCOPe Domain Sequences for d4irha_:

Sequence; same for both SEQRES and ATOM records:

>d4irha_ a.4.5.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssrlanpgsgqiqlwqfllellsdssnsscitwegtngefkmtdpdevarrwgerkskpn
mnydklsralryyydknimtkvhgkryaykfdfhgiaqalqp

Timeline for d4irha_:

• d4irha_ first appeared in SCOPe 2.03
  
• d4irha_ appears in SCOPe 2.04
  
• d4irha_ appears in SCOPe 2.06
  
• d4irha_ appears in the current release, SCOPe 2.08