SCOPe 2.08: Domain d4irga1: 4irg A:289-383

Lineage for d4irga1 (4irg A:289-383)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186924] (29 PDB entries)

8. Domain d4irga1: 4irg A:289-383 [223334]
   Other proteins in same PDB: d4irga2
   automated match to d1k79a_

Details for d4irga1

PDB Entry: 4irg, 1.7 Å

PDB Description: Uninhibited DNA-binding domain of the Ets transcription factor ERG

PDB Compounds: (A:) Transcriptional regulator ERG

SCOPe Domain Sequences for d4irga1:

Sequence; same for both SEQRES and ATOM records:

>d4irga1 a.4.5.0 (A:289-383) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pgsgqiqlwqfllellsdssnsscitwegtngefkmtdpdevarrwgerkskpnmnydkl
sralryyydknimtkvhgkryaykfdfhgiaqalq

Timeline for d4irga1:

• d4irga1 first appeared in SCOPe 2.03, called d4irga_
  
• d4irga1 appears in SCOPe 2.07