SCOP 1.75: Domain d1mspa_: 1msp A:

Lineage for d1mspa_ (1msp A:)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.2: MSP-like [49360] (4 proteins)
   Pfam PF00635

6. Protein Major sperm protein, MSP [49361] (2 species)

7. Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (3 PDB entries)

8. Domain d1mspa_: 1msp A: [22333]

Details for d1mspa_

PDB Entry: 1msp, 2.5 Å

PDB Description: major sperm protein, alpha isoform (recombinant), ph 4.6

PDB Compounds: (A:) major sperm protein

SCOP Domain Sequences for d1mspa_:

Sequence; same for both SEQRES and ATOM records:

>d1mspa_ b.1.11.2 (A:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]}
svppgdintqpsqkivfnapyddkhtyhikitnaggrrigwaikttnmrrlsvdppcgvl
dpkekvlmavscdtfnaatedlnndritiewtntpdgaakqfrrewfqgdgmvrrknlpi
eynl

Timeline for d1mspa_:

• d1mspa_ first appeared (with stable ids) in SCOP 1.55
  
• d1mspa_ appears in SCOP 1.73
  
• d1mspa_ appears in SCOPe 2.01
  
• d1mspa_ appears in the current release, SCOPe 2.08