Lineage for d4ir3a_ (4ir3 A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1267072Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 1267073Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 1267143Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 1267144Protein automated matches [190615] (4 species)
    not a true protein
  7. 1267148Species Human (Homo sapiens) [TaxId:9606] [187641] (145 PDB entries)
  8. 1267313Domain d4ir3a_: 4ir3 A: [223328]
    automated match to d2nxbb_
    complexed with 1fk, edo, gol

Details for d4ir3a_

PDB Entry: 4ir3 (more details), 2 Å

PDB Description: crystal structure of the bromodomain of human baz2b in complex with 1- [7-amino-1-(pyrimidin-2-yl)indolizin-3-yl]ethanone (gsk2833282a)
PDB Compounds: (A:) Bromodomain adjacent to zinc finger domain protein 2B

SCOPe Domain Sequences for d4ir3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ir3a_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
smsvkkpkrddskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstir
eklssgqypnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfkv

SCOPe Domain Coordinates for d4ir3a_:

Click to download the PDB-style file with coordinates for d4ir3a_.
(The format of our PDB-style files is described here.)

Timeline for d4ir3a_: