SCOPe 2.06: Domain d4ir0b_: 4ir0 B:

Lineage for d4ir0b_ (4ir0 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.0: automated matches [191344] (1 protein)
   not a true family

6. Protein automated matches [190239] (20 species)
   not a true protein

7. Species Bacillus anthracis [TaxId:198094] [226573] (4 PDB entries)

8. Domain d4ir0b_: 4ir0 B: [223327]
   Other proteins in same PDB: d4ir0a2, d4ir0a3
   automated match to d1npbc_
   complexed with edo, fcn, zn

Details for d4ir0b_

PDB Entry: 4ir0, 1.6 Å

PDB Description: crystal structure of metallothiol transferase fosb 2 from bacillus anthracis str. ames

PDB Compounds: (B:) Metallothiol transferase fosB 2

SCOPe Domain Sequences for d4ir0b_:

Sequence; same for both SEQRES and ATOM records:

>d4ir0b_ d.32.1.0 (B:) automated matches {Bacillus anthracis [TaxId: 198094]}
lqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveediprneik
qsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefhtgtl
qnrleyykedkkhm

Timeline for d4ir0b_:

• d4ir0b_ first appeared in SCOPe 2.03
  
• d4ir0b_ appears in SCOPe 2.05
  
• d4ir0b_ appears in SCOPe 2.07
  
• d4ir0b_ appears in the current release, SCOPe 2.08