Lineage for d4ir0a1 (4ir0 A:1-139)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942879Family d.32.1.0: automated matches [191344] (1 protein)
    not a true family
  6. 2942880Protein automated matches [190239] (26 species)
    not a true protein
  7. 2942883Species Bacillus anthracis [TaxId:198094] [226573] (4 PDB entries)
  8. 2942889Domain d4ir0a1: 4ir0 A:1-139 [223326]
    Other proteins in same PDB: d4ir0a2, d4ir0a3
    automated match to d1npbc_
    complexed with edo, fcn, zn

Details for d4ir0a1

PDB Entry: 4ir0 (more details), 1.6 Å

PDB Description: crystal structure of metallothiol transferase fosb 2 from bacillus anthracis str. ames
PDB Compounds: (A:) Metallothiol transferase fosB 2

SCOPe Domain Sequences for d4ir0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ir0a1 d.32.1.0 (A:1-139) automated matches {Bacillus anthracis [TaxId: 198094]}
mlqginhicfsvsnleksiefyqkilqakllvkgrklayfdlnglwialnveediprnei
kqsythmaftvtnealdhlkevliqndvnilpgrerderdqrslyftdpdghkfefhtgt
lqnrleyykedkkhmtfyi

SCOPe Domain Coordinates for d4ir0a1:

Click to download the PDB-style file with coordinates for d4ir0a1.
(The format of our PDB-style files is described here.)

Timeline for d4ir0a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d4ir0b_