Lineage for d4iqpa2 (4iqp A:1094-1296)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2053108Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2053846Superfamily b.42.4: STI-like [50386] (3 families) (S)
  5. 2053956Family b.42.4.0: automated matches [191368] (1 protein)
    not a true family
  6. 2053957Protein automated matches [190445] (6 species)
    not a true protein
  7. 2053963Species Clostridium botulinum [TaxId:1491] [225676] (22 PDB entries)
  8. 2053980Domain d4iqpa2: 4iqp A:1094-1296 [223325]
    Other proteins in same PDB: d4iqpa1
    automated match to d1epwa2
    complexed with gol

Details for d4iqpa2

PDB Entry: 4iqp (more details), 2.3 Å

PDB Description: Crystal Structure of HCRA-W1266A
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d4iqpa2:

Sequence, based on SEQRES records: (download)

>d4iqpa2 b.42.4.0 (A:1094-1296) automated matches {Clostridium botulinum [TaxId: 1491]}
sgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnss
lyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipd
vgnlsqvvvmkskndqgitnkckmnlqdnngndigfigfhqfnniaklvasnaynrqier
ssrtlgcswefipvddgwgerpl

Sequence, based on observed residues (ATOM records): (download)

>d4iqpa2 b.42.4.0 (A:1094-1296) automated matches {Clostridium botulinum [TaxId: 1491]}
sgilkdfwgdylqydkpyymlnlydpnkyvdvnnvgirgymylkgprgsvmttniylnss
lyrgtkfiikkyasgnkdnivrnndrvyinvvvknkeyrlatnasqagvekilsaleipd
vgnlsqvvvmksknqgitnkckmnlqdnngndigfigfhqfnniaklvasnaynrqirss
rtlgcswefipvddgwgerpl

SCOPe Domain Coordinates for d4iqpa2:

Click to download the PDB-style file with coordinates for d4iqpa2.
(The format of our PDB-style files is described here.)

Timeline for d4iqpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4iqpa1