Lineage for d4iqpa1 (4iqp A:876-1093)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2780769Species Clostridium botulinum [TaxId:1491] [225675] (24 PDB entries)
  8. 2780784Domain d4iqpa1: 4iqp A:876-1093 [223324]
    Other proteins in same PDB: d4iqpa2
    automated match to d1epwa1
    complexed with gol

Details for d4iqpa1

PDB Entry: 4iqp (more details), 2.3 Å

PDB Description: Crystal Structure of HCRA-W1266A
PDB Compounds: (A:) Botulinum neurotoxin type A

SCOPe Domain Sequences for d4iqpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iqpa1 b.29.1.0 (A:876-1093) automated matches {Clostridium botulinum [TaxId: 1491]}
tsilnlryesnhlidlsryaskinigskvnfdpidknqiqlfnlesskievilknaivyn
smyenfstsfwiripkyfnsislnneytiincmennsgwkvslnygeiiwtlqdtqeikq
rvvfkysqminisdyinrwifvtitnnrlnnskiyingrlidqkpisnlgnihasnnimf
kldgcrdthryiwikyfnlfdkelnekeikdlydnqsn

SCOPe Domain Coordinates for d4iqpa1:

Click to download the PDB-style file with coordinates for d4iqpa1.
(The format of our PDB-style files is described here.)

Timeline for d4iqpa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4iqpa2