SCOPe 2.08: Domain d4iqgc_: 4iqg C:

Lineage for d4iqgc_ (4iqg C:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Polaromonas sp. [TaxId:296591] [226304] (2 PDB entries)

8. Domain d4iqgc_: 4iqg C: [223322]
   Other proteins in same PDB: d4iqga2, d4iqgd2
   automated match to d2c07a1
   complexed with fmt, gol, nap, peg

Details for d4iqgc_

PDB Entry: 4iqg, 1.85 Å

PDB Description: crystal structure of bpro0239 oxidoreductase from polaromonas sp. js666 in nadp bound form

PDB Compounds: (C:) Short-chain dehydrogenase/reductase SDR

SCOPe Domain Sequences for d4iqgc_:

Sequence; same for both SEQRES and ATOM records:

>d4iqgc_ c.2.1.0 (C:) automated matches {Polaromonas sp. [TaxId: 296591]}
skvvlitggsrgigaasallaarqgyavavnyasnsaaadevvrqireaggqalavqadv
akerevlamfetvdaqlgrlsalvnnagvvdqttrvdgitlerlqrmfeinvfgsflcar
eavkrmstryggsggsivnvssaaarlgspgqyvdyaaakgaidtftlglakevategir
vnavrpgiietdihasgglpnrardvapqvpmqragtarevaeaivwllgdqasyttgal
ldvtggr

Timeline for d4iqgc_:

• d4iqgc_ first appeared in SCOPe 2.03
  
• d4iqgc_ appears in SCOPe 2.07