Lineage for d1bf8_1 (1bf8 1-121)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 551801Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 551802Family b.1.11.1: Pilus chaperone [49355] (4 proteins)
  6. 551807Protein Periplasmic chaperone FimC [49358] (1 species)
  7. 551808Species Escherichia coli [TaxId:562] [49359] (4 PDB entries)
  8. 551833Domain d1bf8_1: 1bf8 1-121 [22332]
    Other proteins in same PDB: d1bf8_2

Details for d1bf8_1

PDB Entry: 1bf8 (more details)

PDB Description: periplasmic chaperone fimc, nmr, 20 structures

SCOP Domain Sequences for d1bf8_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bf8_1 b.1.11.1 (1-121) Periplasmic chaperone FimC {Escherichia coli}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a

SCOP Domain Coordinates for d1bf8_1:

Click to download the PDB-style file with coordinates for d1bf8_1.
(The format of our PDB-style files is described here.)

Timeline for d1bf8_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bf8_2