Lineage for d1bf8_1 (1bf8 1-121)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.11: PapD-like [49354] (2 families) 
Family b.1.11.1: Pilus chaperone [49355] (2 proteins) 
Protein Periplasmic chaperone FimC [49358] (1 species) Species Escherichia coli [TaxId:562] [49359] (2 PDB entries) 
Domain d1bf8_1: 1bf8 1-121 [22332]
Other proteins in same PDB: d1bf8_2
Details for d1bf8_1
PDB Entry: 1bf8 (more details)
PDB Description: periplasmic chaperone fimc, nmr, 20 structures
SCOP Domain Sequences for d1bf8_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bf8_1 b.1.11.1 (1-121) Periplasmic chaperone FimC {Escherichia coli}
gvalgatrviypagqkqeqlavtnndenstyliqswvenadgvkdgrfivtpplfamkgk
kentlrildatnnqlpqdreslfwmnvkaipsmdkskltentlqlaiisriklyyrpakl
a
SCOP Domain Coordinates for d1bf8_1:
Click to download the PDB-style file with coordinates for d1bf8_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bf8_1:
- d1bf8_1 appears in SCOP 1.57
- d1bf8_1 appears in the current release, SCOPe 2.08, called d1bf8a1
View in 3D
