Class b: All beta proteins [48724] (177 folds) |
Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily) barrel, open; n*=6, S*=10; greek-key |
Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) |
Family b.46.1.0: automated matches [227262] (1 protein) not a true family |
Protein automated matches [227053] (7 species) not a true protein |
Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226571] (2 PDB entries) |
Domain d4iqfa2: 4iqf A:205-311 [223313] Other proteins in same PDB: d4iqfa1, d4iqfa3, d4iqfb1, d4iqfb3, d4iqfc1, d4iqfc3, d4iqfd1, d4iqfd3 automated match to d1fmta1 complexed with gol, pg5, so4 |
PDB Entry: 4iqf (more details), 2.38 Å
SCOPe Domain Sequences for d4iqfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iqfa2 b.46.1.0 (A:205-311) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} ikreqekidwtktgeevynhirglnpwpvayttlagqvvkvwwgekvpvtksaeagtiva ieedgfvvatgnetgvkitelqpsgkkrmscsqflrgtkpeigtklg
Timeline for d4iqfa2: