Lineage for d4iqea_ (4iqe A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2088020Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 2088358Family c.1.12.0: automated matches [191427] (1 protein)
    not a true family
  6. 2088359Protein automated matches [190614] (15 species)
    not a true protein
  7. 2088360Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226572] (3 PDB entries)
  8. 2088365Domain d4iqea_: 4iqe A: [223310]
    automated match to d3eoob_

Details for d4iqea_

PDB Entry: 4iqe (more details), 2.5 Å

PDB Description: Crystal Structure of Carboxyvinyl-Carboxyphosphonate Phosphorylmutase from Bacillus anthracis str. Ames Ancestor
PDB Compounds: (A:) Carboxyvinyl-carboxyphosphonate phosphorylmutase

SCOPe Domain Sequences for d4iqea_:

Sequence, based on SEQRES records: (download)

>d4iqea_ c.1.12.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
vvnkqstqeelanrfralveaneilqipgahdamaalvarntgflalylsgaaytaskgl
pdlgivtstevaerardlvratdlpvlvdidtgfggvlnvartavemveakvaavqiedq
qlpkkcghlngkklvtteelvqkikaikevapslyivartdargvegldeaieranayvk
agadaifpealqseeefrlfnskvnapllanmtefgktpyysaeefanmgfqmviypvts
lrvaakayenvftliketgsqkdalsnmqtrselyetisyhdfeeldtgiakt

Sequence, based on observed residues (ATOM records): (download)

>d4iqea_ c.1.12.0 (A:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
vvnqstqeelanrfralveaneilqipgahdamaalvarntgflalylsgaaytaskglp
dlgivtstevaerardlvratdlpvlvdidtgfggvlnvartavemveakvaavqiedqq
lpkkcngkklvtteelvqkikaikevapslyivartdargvegldeaieranayvkagad
aifpealqseeefrlfnskvnapllanmtefgktpyysaeefanmgfqmviypvtslrva
akayenvftliketgsqkdalsnmqtrselyetisyhdfeeldtgiakt

SCOPe Domain Coordinates for d4iqea_:

Click to download the PDB-style file with coordinates for d4iqea_.
(The format of our PDB-style files is described here.)

Timeline for d4iqea_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4iqeb_