SCOPe 2.05: Domain d4iqdb_: 4iqd B:

Lineage for d4iqdb_ (4iqd B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families)

5. Family c.1.12.0: automated matches [191427] (1 protein)
   not a true family

6. Protein automated matches [190614] (10 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226572] (2 PDB entries)

8. Domain d4iqdb_: 4iqd B: [223309]
   automated match to d3eoob_
   complexed with pyr

Details for d4iqdb_

PDB Entry: 4iqd, 2 Å

PDB Description: Crystal Structure of Carboxyvinyl-Carboxyphosphonate Phosphorylmutase from Bacillus anthracis

PDB Compounds: (B:) Carboxyvinyl-carboxyphosphonate phosphorylmutase

SCOPe Domain Sequences for d4iqdb_:

Sequence; same for both SEQRES and ATOM records:

>d4iqdb_ c.1.12.0 (B:) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
qstqeelanrfralveaneilqipgahdamaalvarntgflalylsgaaytaskglpdlg
ivtstevaerardlvratdlpvlvdidtgfggvlnvartavemveakvaavqiedqqlpk
kcghlngkklvtteelvqkikaikevapslyivartdargvegldeaieranayvkagad
aifpealqseeefrlfnskvnapllanmtefgktpyysaeefanmgfqmviypvtslrva
akayenvftliketgsqkdalsnmqtrselyetisyhdfeeldtgiakt

Timeline for d4iqdb_:

• d4iqdb_ first appeared in SCOPe 2.03
  
• d4iqdb_ appears in SCOPe 2.04
  
• d4iqdb_ appears in SCOPe 2.06
  
• d4iqdb_ appears in the current release, SCOPe 2.08