Lineage for d4iqab1 (4iqa B:6-91)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1370148Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1370149Protein automated matches [190056] (107 species)
    not a true protein
  7. 1370432Species Human (Homo sapiens) [TaxId:9606] [188013] (58 PDB entries)
  8. 1370586Domain d4iqab1: 4iqa B:6-91 [223306]
    Other proteins in same PDB: d4iqaa2, d4iqab2
    automated match to d1k0ma2
    mutant

Details for d4iqab1

PDB Entry: 4iqa (more details), 2.49 Å

PDB Description: crystal structure analysis of the e228l mutant of human clic1
PDB Compounds: (B:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d4iqab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iqab1 c.47.1.0 (B:6-91) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqvelfvkagsdgakigncpfsqrlfmvlwlkgvtfnvttvdtkrrtetvqklcpggqlp
fllygtevhtdtnkieefleavlcpp

SCOPe Domain Coordinates for d4iqab1:

Click to download the PDB-style file with coordinates for d4iqab1.
(The format of our PDB-style files is described here.)

Timeline for d4iqab1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4iqab2