SCOPe 2.03: Domain d4iqaa2: 4iqa A:92-240

Lineage for d4iqaa2 (4iqa A:92-240)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein automated matches [226848] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224956] (27 PDB entries)

8. Domain d4iqaa2: 4iqa A:92-240 [223305]
   Other proteins in same PDB: d4iqaa1, d4iqab1
   automated match to d1k0ma1
   mutant

Details for d4iqaa2

PDB Entry: 4iqa, 2.49 Å

PDB Description: crystal structure analysis of the e228l mutant of human clic1

PDB Compounds: (A:) chloride intracellular channel protein 1

SCOPe Domain Sequences for d4iqaa2:

Sequence, based on SEQRES records:

>d4iqaa2 a.45.1.1 (A:92-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vdetsaedegvsqrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhryls
nayareefastcpddelielayeqvakal

Sequence, based on observed residues (ATOM records):

>d4iqaa2 a.45.1.1 (A:92-240) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rypklaalnpesntagldifakfsayiknsnpalndnlekgllkalkvldnyltsplpee
vrkfldgneltladcnllpklhivqvvckkyrgftipeafrgvhrylsnayareefastc
pddelielayeqvakal

Timeline for d4iqaa2:

• d4iqaa2 is new in SCOPe 2.03-stable
  
• d4iqaa2 appears in SCOPe 2.04
  
• d4iqaa2 appears in the current release, SCOPe 2.08