Lineage for d4iq7a_ (4iq7 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2330957Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2330958Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2330959Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2330984Protein Cyp121 monooxygenase (P450 Mt2) [81865] (3 species)
  7. 2330987Species Mycobacterium tuberculosis [TaxId:1773] [81866] (37 PDB entries)
  8. 2331013Domain d4iq7a_: 4iq7 A: [223302]
    automated match to d4ipsa_
    complexed with 1g9, hem, so4

Details for d4iq7a_

PDB Entry: 4iq7 (more details), 1.9 Å

PDB Description: Substrate and reaction specificity of Mycobacterium tuberculosis cytochrome P450 CYP121
PDB Compounds: (A:) Cytochrome P450 121

SCOPe Domain Sequences for d4iq7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iq7a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]}
atvllevpfsargdripdavaelrtrepirkvrtitgaeawlvssyalctqvledrrfsm
ketaaagaprlnaltvppevvnnmgniadaglrkavmkaitpkapgleqflrdtanslld
nlitegapadlrndfadplatalhckvlgipqedgpklfrslsiafmssadpipaakinw
drdieymagilenpnittglmgelsrlrkdpayshvsdelfatigvtffgagvistgsfl
ttalisliqrpqlrnllhekpelipagveellrinlsfadglprlatadiqvgdvlvrkg
elvlvlleganfdpehfpnpgsieldrpnptshlafgrgqhfcpgsalgrrhaqigieal
lkkmpgvdlavpidqlvwrtrfqrriperlpvlw

SCOPe Domain Coordinates for d4iq7a_:

Click to download the PDB-style file with coordinates for d4iq7a_.
(The format of our PDB-style files is described here.)

Timeline for d4iq7a_: