| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Mannheimia haemolytica [TaxId:272629] [226567] (2 PDB entries) |
| Domain d4iq1b1: 4iq1 B:1-80 [223298] Other proteins in same PDB: d4iq1a2, d4iq1a3, d4iq1b2, d4iq1b3, d4iq1c2, d4iq1c3 automated match to d2pmta2 complexed with cl, gol |
PDB Entry: 4iq1 (more details), 1.85 Å
SCOPe Domain Sequences for d4iq1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iq1b1 c.47.1.0 (B:1-80) automated matches {Mannheimia haemolytica [TaxId: 272629]}
mklygltgacsfvphvalewvklranqdyafqavsrefiksaeylalnprgnvpllvdgd
laltqnqaivhyldelypea
Timeline for d4iq1b1: