![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins) contains many insertions in the common fold automatically mapped to Pfam PF00840 |
![]() | Protein automated matches [190170] (17 species) not a true protein |
![]() | Species Limnoria quadripunctata [TaxId:161573] [197311] (4 PDB entries) |
![]() | Domain d4ipma1: 4ipm A:24-453 [223294] Other proteins in same PDB: d4ipma2 automated match to d4hapb_ complexed with act, ca |
PDB Entry: 4ipm (more details), 1.14 Å
SCOPe Domain Sequences for d4ipma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ipma1 b.29.1.10 (A:24-453) automated matches {Limnoria quadripunctata [TaxId: 161573]} qagteteeyhlpltwerdgssvsasvvidsnwrwthstedttncydgnewdstlcpdadt ctencaidgvdqgtwgdtygitasgskltlsfvtegeystdigsrvflmadddnyeifnl ldkefsfdvdasnlpcglngalyfvsmdedggtskystntagakygtgycdaqcphdmkf iagkansdgwtpsdndqnagtgemgacchemdiweansqaqsytahvcsvdgytpctgtd cgdngddrykgvcdkdgcdyaayrlgqhdfygeggtvdsgstltvitqfitgggglneir riyqqggqtiqnaavnfpgdvdpydsitedfcvdikryfgdtndfdakggmsgmsnalkk gmvlvmslwddhyanmlwldatypvdstepgalrgpcstdsgdpadveanfpgstvtfsn ikigpiqsyd
Timeline for d4ipma1: