Lineage for d4ip3b_ (4ip3 B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1406945Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 1406946Superfamily d.20.1: UBC-like [54495] (5 families) (S)
  5. 1407249Family d.20.1.0: automated matches [191322] (1 protein)
    not a true family
  6. 1407250Protein automated matches [190120] (5 species)
    not a true protein
  7. 1407255Species Human (Homo sapiens) [TaxId:9606] [186843] (8 PDB entries)
  8. 1407258Domain d4ip3b_: 4ip3 B: [223290]
    automated match to d3ptfb_

Details for d4ip3b_

PDB Entry: 4ip3 (more details), 2.3 Å

PDB Description: Complex structure of OspI and Ubc13
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 N

SCOPe Domain Sequences for d4ip3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ip3b_ d.20.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aglprriiketqrllaepvpgikaepdesnaryfhvviagpqdspfeggtfklelflpee
ypmaapkvrfmtkiyhpnvdklgricldilkdkwspalqirtvllsiqallsapnpddpl
andvaeqwktneaqaietarawtrlyamnni

SCOPe Domain Coordinates for d4ip3b_:

Click to download the PDB-style file with coordinates for d4ip3b_.
(The format of our PDB-style files is described here.)

Timeline for d4ip3b_: