Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) |
Family c.1.1.0: automated matches [191424] (1 protein) not a true family |
Protein automated matches [190605] (25 species) not a true protein |
Species Escherichia coli [TaxId:316385] [226569] (1 PDB entry) |
Domain d4iota_: 4iot A: [223288] automated match to d2vomd_ complexed with so4 |
PDB Entry: 4iot (more details), 1.85 Å
SCOPe Domain Sequences for d4iota_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4iota_ c.1.1.0 (A:) automated matches {Escherichia coli [TaxId: 316385]} mrhplvmgnwklngsrhmvhelvsnlrkelagvagcavaiappemyidmakreaegshim lgaqnvdlnlsgaftgetsaamlkdigaqyiiighserrtyhkesdeliakkfavlkeqg ltpvlcigeteaeneagkteevcarqidavlktqgaaafegaviayepvwaigtgksatp aqaqavhkfirdhiakvdaniaeqviiqyggsvnasnaaelfaqpdidgalvggaslkad afavivkaaeaakq
Timeline for d4iota_: